Humans logo

Ways to Enhance Your Memory Instantly!

Improving Your Memory

By Chelsi.DPublished 2 years ago 2 min read
Expanding Your Social Circle And Making New Friends

From misplacing keys to struggling to retain information for an exam, we often wish for a sharper memory. How can science help enhance our memory in the present moment?

To begin, prioritize hitting the gym, and remember that cardio is essential. Research using MRI scans indicates that engaging in regular aerobic activities, such as running, can enhance memory performance by boosting blood flow and volume in specific regions of the hippocampus. Given that the hippocampus plays a crucial role in learning and memory, this finding is significant, especially considering that this brain area tends to shrink by one to two percent annually in older adults. Therefore, incorporating aerobic exercise into your routine can help combat age-related memory decline.

Additionally, before studying, ensure you have a nutritious snack. Consuming a meal has been linked to increased levels of glucose and insulin, which have been shown to support the acquisition of new information. These substances are also vital for consolidation, the process of converting short-term memories into long-term ones, likely due to their impact on the hippocampus.

Earlier, we discussed how a diet rich in insulin receptors can be beneficial. Consider incorporating blueberries into your routine, as studies have demonstrated that participants who took a blueberry supplement showed improved ability to recall past events. Blueberries are packed with flavonoids known to safeguard neurons, enhance their functionality, and promote their regeneration.

It's important to stay connected with your social circle, as research suggests that strong personal relationships are linked to better memory. A 2017 study revealed that older adults who reported more fulfilling relationships had cognitive abilities comparable to individuals in their 50s and 60s. Additionally, spending time with others has been shown to help prevent memory decline often associated with dementia.

Researchers suggest that our friends exert social pressure that encourages us to prioritize self-care. They may subtly or overtly prompt us to seek medical attention when needed. Interacting socially presents cognitive and memory challenges that can stimulate brain activity. Therefore, value your friendships as they play a role in improving memory. If you are interested in fully leveraging these advantages, you might want to explore the realm of memory champions. These individuals showcase exceptional memory abilities, like memorizing a deck of cards' sequence in a mere 30 seconds.

Superior memory skills are not solely attributed to anatomical variances, implying that you can attain similar memory capabilities through dedicated practice. A study revealed that after six weeks of daily 30-minute training, regular individuals demonstrated neural connectivity levels comparable to memory athletes. Their ability to recall words also significantly improved, with the capacity to remember over 60 words from an initial 26 to 30 words.

If you're feeling anxious about memorizing a presentation for tomorrow, there's no need to fret. Research indicates that an optimal level of anxiety can enhance memory retention during stressful situations. Hormones like cortisol play a role in facilitating the formation of long-term memories, aiding in processing stress-inducing events and adapting behaviors accordingly. It's important to note that excessive stress can hinder memory function, highlighting the significance of striking a balance between maintaining composure and experiencing a moderate level of stress to sharpen cognitive abilities.

advicefamilyfriendshipsciencehumanitysocial mediahow tolove

About the Creator

Chelsi.D

"Logic will get you from A to B. Imagination will take you everywhere." -Albert Einstein

Enjoyed the story? Support the Creator.

Subscribe for free to receive all their stories in your feed.

Subscribe For Free

Reader insights

Comments

There are no comments for this story

Be the first to respond and start the conversation.

Sign in to comment
    Written by Chelsi.D