Humans logo

12 Alarming Traits of a Selfish Husband and What They Mean for Your Relationship

Discover the warning signs of a self-centered spouse and learn what they might mean for your relationship.

By Milan MilicPublished 2 years ago 5 min read
AI Generated Image

Marriage is regularly painted as a lovely partnership, a commitment to love and support each other through thick and lean. But what happens when one individual appears to prioritize their needs at each turn, taking off their partner feeling ignored, overlooked, and indeed confined? In numerous connections, the root of such awkwardness is selfishness—a propensity that can leak into all zones of marriage, regularly unnoticed until it's as well late. Here, we'll jump into 12 inconspicuous, however, telling signs of a selfish husband and what these behaviors may be cruel for your relationship.

1. He Doesn’t Listen (Or Pretends To)

Listening is fundamental in any relationship. A selfish husband might seem present but could be mentally checked out when you're talking, or worse, he might dominate conversations without considering your thoughts. Instead of active listening, he might give a quick nod, a shallow "uh-huh," or even change the subject to something that interests him. This lack of genuine interest in your words may make you feel invisible—a surefire way to dampen emotional connection.

Protect your relationship!

2. The Relationship Is All About His Needs

Do you ever feel like your husband sees you as an extra to his life instead of a break-even with an accomplice? Selfish spouses regularly act as in case their needs—whether passionate, physical, or indeed financial—should continuously come to begin with. This attitude turns what ought to be a shared encounter into a one-sided undertaking, making you feel more like a caretaker than a cherished accomplice.

3. He Rarely Shows Appreciation

In a balanced marriage, both partners express gratitude, whether it’s for small favors or simply being there for each other. But a selfish husband? He might expect you to do things for him as if it’s your duty, showing little to no appreciation in return. If you find yourself longing for a simple “thank you” and only getting silence, this could be a red flag of a self-centered spouse.

4. His Apologies (If Any) Are Insincere

An apology is supposed to repair hurt feelings and mend misunderstandings, but a selfish husband often sidesteps this responsibility. Instead, he may brush off issues with an insincere "sorry" or, worse, avoid apologizing altogether. His lack of genuine remorse can make you feel like your emotions and experiences don’t matter to him.

5. Financial Decisions Are His Domain

Money may be a touchy subject, and dealing with it requires belief and straightforwardness. In an egotistical marriage, in any case, a spouse might take full control of financial things, expelling your conclusions or making critical choices without examining them with you. In case he keeps you within the dim almost accounts or denies to collaborate, he's successfully sidelining you from a pivotal portion of your shared life.

Protect your relationship!

6. He Expects Special Treatment

Does your husband seem to believe he's entitled to special treatment, even when it’s not warranted? A selfish husband may expect his needs to be prioritized over everyone else’s, often without recognizing that others might have equally important needs. He may anticipate that you’ll cater to him, regardless of your responsibilities, as if his happiness takes precedence.

7. Compromise Is a Foreign Concept

Healthy relationships flourish on compromise, where both partners meet within the center. But on the off chance that your husband persistently demands to have his way, disregarding your suppositions wants or needs, it may be a sign of a selfish mentality. In such cases, his refusal to compromise reveals that he values his wants over the collective well-being of the relationship.

8. His Schedule Always Takes Priority

Life is busy, but in marriage, both partners should work together to balance their schedules. A selfish husband, however, will prioritize his plans, expecting you to adjust yours around him. This might mean consistently missing important events in your life, rescheduling family plans, or disregarding your needs without hesitation—all because he deems his schedule more important.

9. He Belittles Your Achievements

Selfishness often reveals itself in a lack of support for your personal growth. If your husband is unwilling to celebrate your successes or, worse, downplays your achievements, it’s a clear indication of self-centeredness. A partner who values himself over others may feel threatened by your accomplishments rather than feeling proud, leading to subtle (or not-so-subtle) acts of belittlement.

10. Emotional Support? Not in His Vocabulary

Marriage is a partnership, and a portion of that partnership includes being there emotionally for one another. A selfish husband may well be physically showing but sincerely missing, expelling your sentiments or reframing the discussion around his issues. This need for compassion can make you feel disconnected, particularly amid troublesome times after you require him most.

Protect your relationship!

11. He Makes Major Decisions Without Consulting You

In a marriage, huge decisions—whether it's buying a home, changing occupations, or indeed making way of life choices—are in a perfect world made together. But a childish spouse might take it upon himself to create these choices without your input, treating you more like a bystander than an accomplice. This neglect of your opinions can make you feel frail and underestimated in your own life.

12. He’s Consistently Unavailable

A selfish husband will regularly make himself inaccessible when it's badly arranged for him, prioritizing his needs or interface over investing quality time with you. Whether it's continually working late, reveling in individual side interests, or essentially disregarding you in favor of screen time, this behavior signals a need for commitment to the relationship.

Conclusion: Finding Balance in the Relationship

Selfishness can be destructive in any relationship, especially in marriage, where partnership, respect, and empathy are vital. Recognizing these signs in your companion isn't fundamentally cruel; the marriage is destined. Communication and counseling can frequently bring such issues to light and cultivate important alterations if both accomplices are willing. However, if your husband's self-centeredness is profoundly imbued and he's unwilling to work on it, you will have to reevaluate your relationship's future.

In conclusion, everybody merits a relationship established in common regard, shared values, and bolster. No one ought to feel like they're on a one-way road, continuously giving without accepting. After all, a marriage isn't a solo journey—it's an organization built on adore, understanding, and the basic, however significant, act of appearing up for one another day after day.

Protect your relationship!

#SelfishHusband #MarriageAdvice #RelationshipRedFlags #MarriageHelp #RelationshipAdvice #MarriageStruggles #HealthyRelationships #MarriageSupport #LoveAndRespect #MarriageMatters #SignsOfSelfishness #RelationshipAwareness #ToxicRelationships #MarriageCounseling #RelationshipInsights

divorcebreakupsadvicemarriagefamilyfriendshipdatinghow tofact or fictionlove

About the Creator

Milan Milic

Hi, I’m Milan. I write about love, fear, money, and everything in between — wherever inspiration goes. My brain doesn’t stick to one genre.

Enjoyed the story? Support the Creator.

Subscribe for free to receive all their stories in your feed.

Subscribe For Free

Reader insights

Comments

There are no comments for this story

Be the first to respond and start the conversation.

Sign in to comment
    Written by Milan Milic