Humans logo

How can I lose weight healthy and permanently?

How can I lose weight healthy and permanently?

By MEHMET AKHANPublished 4 years ago • 3 min read

Introduction

If you're looking to lose weight, the first thing to do is make sure that you're eating right and exercising regularly. Here are some ways that can help you get started on your path to healthy living:

Diet

The first step to losing weight healthy and permanently is to eat less. In fact, it's the most important thing you can do. When we're trying to lose weight, our bodies will naturally try to protect themselves by decreasing their food intake—and in order to do that successfully, they need all the calories they can get.

The second step is exercise! And not just any kind of exercise: The type that burns fat fast (like running or dancing) works best here because those activities cause more heat production than other kinds of physical activity would have done on their own without the added benefit from burning fat during exercise itself.

Create a calorie deficit: This can be achieved by reducing your daily calorie intake or increasing physical activity to burn more calories.

Eat a balanced diet: Focus on nutrient-dense foods such as fruits, vegetables, whole grains, and lean protein sources. Limit your intake of added sugars and unhealthy fats.

Incorporate physical activity: Aim for at least 150 minutes of moderate-intensity or 75 minutes of vigorous-intensity exercise per week. Mix in both cardio and strength training.

Stay hydrated: Drink plenty of water and limit your intake of sugary drinks.

Get enough sleep: Aim for 7-9 hours of sleep per night to help regulate hormones that control appetite and metabolism.

Be patient and consistent: Weight loss is a gradual process, so don't expect rapid results. Stick to healthy habits consistently over time for long-term success.

Exercise

Exercise is the best way to lose weight and build muscle. If you want to lose weight, exercise is the only thing you can do to make sure that happens.

It's not just about burning calories—it's also about building muscle mass so that your body uses more energy when it needs it, which makes it easier for you to burn off those extra calories by doing more activity or sustained exertion (like walking).

Exercise also helps people sleep better at night because studies have shown that exercise makes people feel better physically and mentally during the day!

of exercise a little more, what are some other benefits of exercise beyond just weight loss and muscle building?

Exercise has numerous health benefits such as:

Improved cardiovascular health

Stronger bones and reduced risk of osteoporosis

Better mood and reduced risk of depression and anxiety

Improved cognitive function and reduced risk of dementia

Improved immune function

Improved digestion and gut health

Increased energy levels and overall physical fitness.

In summary, exercise is not just about appearance, it also has numerous physical and mental health benefits that contribute to overall well-being.

Supplements

Supplements can be a great way to boost your health, but they're not a long-term solution. Before you add any supplements to your diet, check with your doctor first. Some supplements can have side effects that might not be worth the risk for some people and may even cause harm if you don't know about them beforehand.

If you decide that taking supplements is right for you, here are some things to keep in mind:

Always read the label carefully and follow directions exactly as written by manufacturer!

Make sure it's safe for children too—if not, consider getting something else instead.

My suggestion: https://amzn.to/40cL4Sj

You can do it

It’s not easy, but you will get there if you keep trying. If you stay positive and keep going, then eventually the weight will come off. It may take a few months or even years of dedication before results start to appear, but they will definitely come with time!

Just remember that this is a marathon not a sprint; don’t give up when things get tough because they will always get tougher than what they seem right now!

Conclusion

You can do it. You have the power to take control of your weight and body, no matter what life throws at you. The key is to be smart and make changes that work for you. Don't try to go it alone—talk with friends, family members, or professionals who will give their honest opinion on what works best for you personally!

celebritiesmarriagefamilyfriendshiptravelhumanitydatingsocial medialove

About the Creator

MEHMET AKHAN

Enjoyed the story? Support the Creator.

Subscribe for free to receive all their stories in your feed.

Subscribe For Free

Reader insights

Comments

There are no comments for this story

Be the first to respond and start the conversation.

Sign in to comment
    Written by MEHMET AKHAN